Anti-LRIG3 polyclonal antibody (DPAB-DC490)

Mouse anti-Human LRIG3 (aa 1020-1119) polyclonal antibody for WB, ELISA Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
LRIG3 (NP_700356, 1020 a.a. ~ 1119 a.a) partial recombinant protein with GST tag. The sequence is LDFSANPEPASVASSNSFMGTFGKALRRPHLDAYSSFGQPSDCQPRAFYLKAHSSPDLDSGSEEDGKERTDFQEENHICTFKQTLENYRTPNFQSYDLDT
Conjugate
Unconjugated

Target


Alternative Names
LRIG3; leucine-rich repeats and immunoglobulin-like domains 3; LIG3; leucine-rich repeats and immunoglobulin-like domains protein 3; LIG-3
Entrez Gene ID
UniProt ID

Citations


Have you cited DPAB-DC490 in a publication? Let us know and earn a reward for your research.

References


Zeitz, C; Jacobson, SG; et al. Whole-Exome Sequencing Identifies LRIT3 Mutations as a Cause of Autosomal-Recessive Complete Congenital Stationary Night Blindness. AMERICAN JOURNAL OF HUMAN GENETICS 92:67-75(2013).

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-LRIG3 polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket