Synthetic peptide within Human KRT78 aa 259-307 (internal sequence). The exact sequence is proprietary.Sequence: TQASDTSVVLSMDNNRYLDFSSIITEVRARYEEIARSSKAEAEALYQTK Database link: Q8N1N4
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
KRT78; keratin 78; K5B; Kb40; keratin, type II cytoskeletal 78; K78; CK-78; keratin 5b; keratin-5b; keratin-78; cytokeratin-78; type-II keratin Kb40;
This gene is a member of the type II keratin gene family and encodes a protein with an intermediate filament domain. Keratins are the major structural proteins in epithelial cells, forming a cytoplasmic network of 10 to 12 nm wide intermediate filaments and creating a scaffold that gives cells the ability to withstand mechanical and non-mechanical stresses. The genes of the type II keratin family are located as a gene cluster at 12p13.13. Four pseudogenes of this gene family have been identified.
Custom Antibody Labeling
We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More
Citations
Have you cited DPABH-12721 in a publication? Let us know and earn a reward for your research.
Gerald, WL; Ladanyi, M; et al. Clinical, pathologic, and molecular spectrum of tumors associated with t(11;22)(p13;q12): Desmoplastic small round-cell tumor and its variants. JOURNAL OF CLINICAL ONCOLOGY 16:3028-3036(1998).
Glickman, JN; Torres, C; et al. The prognostic significance of lymph node micrometastasis in patients with esophageal carcinoma. CANCER 85:769-778(1999).
Payment methods we support:
Invoice / Purchase Order
Credit card
My Review for Anti-KRT78 polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Certificate of Analysis