Anti-KRT78 (aa 259-307) polyclonal antibody

Antibody Isotype

IgG

Species Reactivity

Human

Immunogen

Synthetic peptide within Human KRT78 aa 259-307 (internal sequence). The exact sequence is proprietary.Sequence: TQASDTSVVLSMDNNRYLDFSSIITEVRARYEEIARSSKAEAEALYQTK Database link: Q8N1N4

Conjugate

Application Notes

WB: 1 μg/ml;

Alternative Names

KRT78; keratin 78; K5B; Kb40; keratin, type II cytoskeletal 78; K78; CK-78; keratin 5b; keratin-5b; keratin-78; cytokeratin-78; type-II keratin Kb40;

Entrez Gene ID

UniProt ID

Antigen Description

This gene is a member of the type II keratin gene family and encodes a protein with an intermediate filament domain. Keratins are the major structural proteins in epithelial cells, forming a cytoplasmic network of 10 to 12 nm wide intermediate filaments and creating a scaffold that gives cells the ability to withstand mechanical and non-mechanical stresses. The genes of the type II keratin family are located as a gene cluster at 12p13.13. Four pseudogenes of this gene family have been identified.