Anti-KRT6B polyclonal antibody (DPABH-09517)

Mouse anti-Human KRT6B (full length) polyclonal antibody for WB Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Mouse
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Full length protein corresponding to Human KRT6B aa 1-564.Sequence: MASTSTTIRSHSSSRRGFSANSARLPGVSRSGFSSISVSRSRGSGGLGGA CGGAGFGSRSLYGLGGSKRISIGGGSCAISGGYGSRAGGSYGFGGAGSGF GFGGGAGIGFGLGGGAGLAGGFGGPGFPVCPPGGIQEVTVNQSLLTPLNL QIDPAIQRVRAEEREQIKTLNNKFASFIDKVRFL
Conjugate
Unconjugated

Applications


Application Notes
WB: 1 μg/ml.
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
KRT6B; keratin 6B; keratin like 1 (a type II keratin sequence); KRTL1; keratin, type II cytoskeletal 6B; keratin-6B
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-09517 in a publication? Let us know and earn a reward for your research.

References


Kierszenbaum, AL; Rosselot, C; et al. Role of integrins, tetraspanins, and ADAM proteins during the development of apoptotic bodies by spermatogenic cells. MOLECULAR REPRODUCTION AND DEVELOPMENT 73:906-917(2006).
Mori, Y; Aki, K; et al. UV B-irradiation enhances the racemization and isomerizaiton of aspartyl residues and production of N-epsilon-carboxymethyl lysine (CML) in keratin of skin. JOURNAL OF CHROMATOGRAPHY B-ANALYTICAL TECHNOLOGIES IN THE BIOMEDICAL AND LIFE SCIENCES 879:3303-3309(2011).

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-KRT6B polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket