Synthetic peptide corresponding to a region within amino acids 396-445 (VGGCLHELGPNRRSSQSEDMLTVQSYNTVTRQWLYLKENTSKSGLNLTC A) of Human KLHDC5 (NP_065833).
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
KLHL42; kelch-like family member 42; Ctb9; KLHDC5; kelch-like protein 42; kelch domain containing 5; cullin-3-binding protein 9; kelch-like family, member 42; kelch domain-containing protein 5;
KLHDC5 contains 1 BTB (POZ) domain and 6 Kelch repeats. It is phosphorylated upon DNA damage, possibly by ATM or ATR. The exact function of KLHDC5 is currently unknown.
Citations
Publication ()
Have you cited DPABH-18845 in a publication? Let us know and earn a reward for your research.
My Review for Anti-KLHL42 (aa 396-445) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
