Anti-KLHL3 (aa 1-65) polyclonal antibody

Species Reactivity

Human

Immunogen

KLHL3 (NP_059111, 1 a.a. ~ 65 a.a) partial recombinant protein with GST tag. The sequence is MEGESVKLSSQTLIQAGDDEKNQRTITVNPAHMGKAFKVMNELRSKQLLCDVMIVAEDVE IEAHR

Conjugate

Alternative Names

KLHL3; kelch-like family member 3; PHA2D; kelch-like protein 3;

Entrez Gene ID

UniProt ID

Antigen Description

This gene is ubiquitously expressed and encodes a full-length protein which has an N-terminal BTB domain followed by a BACK domain and six kelch-like repeats in the C-terminus. These kelch-like repeats promote substrate ubiquitination of bound proteins via interaction of the BTB domain with the CUL3 (cullin 3) component of a cullin-RING E3 ubiquitin ligase (CRL) complex. Muatations in this gene cause pseudohypoaldosteronism type IID (PHA2D); a rare Mendelian syndrome featuring hypertension, hyperkalaemia and metabolic acidosis. Alternative splicing results in multiple transcript variants encoding distinct isoforms.