KLF9 (NP_001197, 25 a.a. ~ 101 a.a) partial recombinant protein with GST tag. The sequence is PEHGVAPDAERLRLPEREVTKEHGDPGDTWKDYCTLVTIAKSLLDLNKYRPIQTPSVCSD SLESPDEDMGSDSDVTT
Conjugate
Unconjugated
Target
Alternative Names
KLF9; Kruppel-like factor 9; BTEB; BTEB1; Krueppel-like factor 9; BTE-binding protein 1; GC-box-binding protein 1; transcription factor BTEB1; basic transcription element binding protein 1; basic transcription element-binding protein 1;
The protein encoded by this gene is a transcription factor that binds to GC box elements located in the promoter. Binding of the encoded protein to a single GC box inhibits mRNA expression while binding to tandemly repeated GC box elements activates transcription.
Pathway
Diurnally regulated genes with circadian orthologs;
Citations
Publication ()
Have you cited DPAB-DC3008 in a publication? Let us know and earn a reward for your research.
My Review for Anti-KLF9 (aa 25-101) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
