KLF3 (NP_057615, 1 a.a. ~ 69 a.a) partial recombinant protein with GST tag. The sequence is MLMFDPVPVKQEAMDPVSVSYPSNYMESMKPNKYGVIYSTPLPEKFFQTPEGLSHGIQME PVDLTVNKR
KLF3 (Kruppel-like factor 3 (basic)) is a protein-coding gene. Diseases associated with KLF3 include stomach cancer, and myeloid leukemia. GO annotations related to this gene include DNA binding and sequence-specific DNA binding transcription factor activity. An important paralog of this gene is KLF1.
Pathway
Transcriptional misregulation in cancer;
Citations
Publication ()
Have you cited DPAB-DC2146 in a publication? Let us know and earn a reward for your research.
My Review for Anti-KLF3 (aa 1-69) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
