Synthetic peptide within Human KIF24 aa 934-983 (C terminal). The exact sequence is proprietary.Sequence: SLAEKPYCSQVDFIYRQERGGGSSFDLRKDASQSEVSGENEGNLPSPEED Database link: Q5T7B8
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
KIF24; kinesin family member 24; C9orf48; bA571F15.4; kinesin-like protein KIF24;
This gene encodes a protein containing two coiled-coil regions. The encoded protein promotes Rho/ROCK (Rho-kinase) signaling in cardiac muscles cells, and may facilitate myofibrillar organization.
Citations
Publication ()
Have you cited DPABH-12945 in a publication? Let us know and earn a reward for your research.
My Review for Anti-KIF24 (aa 934-983) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
