Rabbit Anti-KCNJ10 Polyclonal antibody (DPABH-24758)

Rabbit Anti-Human KCNJ10 Polyclonal antibody for WB, IP, IHC, IF, ELISA Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human, Mouse, Rat
Immunogen
Kir4.1 fusion protein, sequence: ETIRFSQHAVVASHNGKPCLMIRVANMRKSLLIGCQVTGKLLQTHQTKEGENIRLNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGSALSVRISNV (C-term-200aa encoded by BC034036)
Conjugate
unconjugated

Applications


Application Notes
WB: 1:500-1:1000
IP: 0.5-4.0 ug for IP and 1:500-1:1000 for WB
IHC: 1:50-1:500
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Target


Alternative Names
KCNJ10; potassium channel, inwardly rectifying subfamily J, member 10; KIR1.2; KIR4.1; SESAME; BIRK-10
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-24758 in a publication? Let us know and earn a reward for your research.

References


Srivastava, R; Aslam, M; et al. Potassium Channel KIR4.1 as an Immune Target in Multiple Sclerosis. NEW ENGLAND JOURNAL OF MEDICINE 367:115-123(2012).
Sage, CL; Marcus, DC; et al. Immunolocalization of CIC-K chloride channel in strial marginal cells and vestibular dark cells. HEARING RESEARCH 160:1-9(2001).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name
Phone *
E-mail Address *
Service & Products Interested *
Project Description
Verification Code * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Rabbit Anti-KCNJ10 Polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket