A synthetic peptide corresponding to a region within amino acids 72-121 (WVPPCCGTASAVIGLLYPCIDRHLGEPHKFKREWSSVMRCVAVFVGINH A) of Human Insig2 (NP_057217)
Insig2 is highly similar to the protein product encoded by gene Insig1. Both Insig1 protein and Insig2 protein are endoplasmic reticulum proteins that block the processing of sterol regulatory element binding proteins (SREBPs) by binding to SREBP cleavage-activating protein (SCAP), and thus prevent SCAP from escorting SREBPs to the Golgi.
Pathway
Metabolism; Regulation of cholesterol biosynthesis by SREBP (SREBF);
Citations
Publication ()
Have you cited DPABH-18777 in a publication? Let us know and earn a reward for your research.
My Review for Anti-INSIG2 (aa 72-121) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
