Anti-IMMP2L (aa 31-102) polyclonal antibody

Species Reactivity

Human

Immunogen

IMMP2L (NP_115938, 31 a.a. ~ 102 a.a) partial recombinant protein with GST tag. The sequence is DRVACVARVEGASMQPSLNPGGSQSSDVVLLNHWKVRNFEVHRGDIVSLVSPKNPEQKII KRVIALEGDIVR

Conjugate

Alternative Names

IMMP2L; IMP2 inner mitochondrial membrane peptidase-like (S. cerevisiae); IMP2; IMP2-LIKE; IMMP2L-IT1; mitochondrial inner membrane protease subunit 2; inner mitochondrial membrane peptidase 2 like; IMMP2L intronic transcript 1 (non-protein coding);

Entrez Gene ID

UniProt ID

Antigen Description

This gene encodes a protein involved in processing the signal peptide sequences used to direct mitochondrial proteins to the mitochondria. The encoded protein resides in the mitochondria and is one of the necessary proteins for the catalytic activity of the mitochondrial inner membrane peptidase (IMP) complex. Two variants that encode the same protein have been described for this gene.

Pathway

Protein export;