Anti-HTR2B (aa 1-56) polyclonal antibody

Species Reactivity

Human

Immunogen

HTR2B (NP_000858, 1 a.a. ~ 56 a.a) partial recombinant protein with GST tag. The sequence is MALSYRVSELQSTIPEHILQSTFVHVISSNWSGLQTESIPEEMKQIVEEQGNKLHW

Conjugate

Alternative Names

HTR2B; 5-hydroxytryptamine (serotonin) receptor 2B, G protein-coupled; 5-HT2B; 5-HT(2B); 5-hydroxytryptamine receptor 2B; 5-HT-2B; 5-HT 2B receptor; serotonin receptor 2B; 5-hydroxytryptamine 2B receptor; 5-hydroxytryptamine receptor 2B variant b;

Entrez Gene ID

UniProt ID

Antigen Description

This gene encodes one of the several different receptors for 5-hydroxytryptamine (serotonin) that belongs to the G-protein coupled receptor 1 family. Serotonin is a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. Serotonin receptors mediate many of the central and peripheral physiologic functions of serotonin, including regulation of cardiovascular functions and impulsive behavior. Population and family-based analyses of a minor allele (glutamine-to-stop substitution, designated Q20*) which blocks expression of this protein, and knockout studies in mice, suggest a role for this gene in impulsivity. However, other factors, such as elevated testosterone levels, may also be involved.

Pathway

Amine ligand-binding receptors; Calcium signaling pathway; G alpha (q) signalling events; GPCR ligand binding