HTR1F (NP_000857, 203 a.a. ~ 279 a.a) partial recombinant protein with GST tag. The sequence is KIYRAAKTLYHKRQASRIAKEEVNGQVLLESGEKSTKSVSTSYVLEKSLSDPSTDFDKIH STVRSLRSEFKHEKSWR
HTR1F (5-hydroxytryptamine (serotonin) receptor 1F, G protein-coupled) is a protein-coding gene. Diseases associated with HTR1F include glycogen storage disease iv, and dyslexia, and among its related super-pathways are Class A/1 (Rhodopsin-like receptors) and Monoamine GPCRs. GO annotations related to this gene include serotonin binding and serotonin receptor activity. An important paralog of this gene is HTR2A.
Pathway
Amine ligand-binding receptors; G alpha (i) signalling events; GPCR ligand binding; GPCRs, Other
Citations
Publication ()
Have you cited DPAB-DC1633 in a publication? Let us know and earn a reward for your research.
My Review for Anti-HTR1F (aa 203-279) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
