HOXD8 (NP_062458, 126 a.a. ~ 190 a.a) partial recombinant protein with GST tag. The sequence is GIACHGEPAKFYGYDNLQRQPIFTTQQEAELVQYPDCKSSSGNIGEDPDHLNQSSSPSQM FPWMR
Conjugate
Unconjugated
Target
Alternative Names
HOXD8; homeobox D8; HOX4; HOX4E; HOX5.4; homeobox protein Hox-D8; Hox-4.5; homeo box 4E; homeo box D8; homeobox protein 5.4; homeobox protein Hox-4E; homeobox protein Hox-5.4;
This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located in a cluster on chromosome 2. Deletions that remove the entire HOXD gene cluster or the 5 end of this cluster have been associated with severe limb and genital abnormalities. In addition to effects during embryogenesis, this particular gene may also play a role in adult urogenital tract function. Alternate splicing results in multiple transcript variants.[provided by RefSeq, Dec 2010]
Citations
Publication ()
Have you cited DPAB-DC1602 in a publication? Let us know and earn a reward for your research.
My Review for Anti-HOXD8 (aa 126-190) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
