Rabbit Anti-Human HOXA5 Polyclonal Antibody (DPABH-11958)

Specifications


Host Species
Rabbit
Antibody Isotype
IgG
Species Reactivity
Human
Immunogen
Recombinant Protein, antigen sequence: MHSGRYGYGYNGMDLSVGRSGSGHFGSGERARSYAASASAAPAEPRYSQPATSTHSPQPDPLPCSAVAPSPGSDSHHGGKNSLSNSSGASADAGSTHISSREGVGTASGAEEDAPASSEQASAQSEPSPAPPAQPQIYPWMRKLHISHDN
Conjugate
Unconjugated

Applications


Application Notes
IHC: 1:20 - 1:50
WB: 0.4 µg/ml
*Suggested working dilutions are given as a guide only. It is recommended that the user titrates the product for use in their own experiment using appropriate negative and positive controls.

Data Examples


Immunohistochemical staining of human colon shows strong cytoplasmic positivity in glandular cells.
Western blot analysis in control (vector only transfected HEK293T lysate) and HOXA5 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (~3.1 kDa) in mammalian HEK293T cells, LY412744).

Target


Alternative Names
HOXA5; homeobox A5; HOX1; HOX1C; HOX1.3; homeobox protein Hox-A5
Entrez Gene ID
UniProt ID

Citations


Have you cited DPABH-11958 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Fernandez, CC; Gudas, LJ; et al. The Truncated Hoxa1 Protein Interacts With Hoxa1 and Pbx1 in Stem Cells. JOURNAL OF CELLULAR BIOCHEMISTRY 106:427-443(2009).
Gaur, A; Bhatia, R; et al. The heart of metamorphosing Mexican axolotl but not that of the cardiac mutant is associated with the upregulation of Hox A5. BIOCHEMICAL AND BIOPHYSICAL RESEARCH COMMUNICATIONS 245:746-751(1998).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Technology Interest:
Type of Organization:
Service & Products Interested: *
Project Description:

Related Products

Related Resources

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

Inquiry Basket