HMG2L1 (NP_001003681, 1 a.a. ~ 74 a.a) partial recombinant protein with GST tag. The sequence is MAYDDSVKKEDCFDGDHTFEDIGLAAGRSQREKKRSYKDFLREEEEIAAQVRNSSKKKLK DSELYFLGTDTHKK
Conjugate
Unconjugated
Target
Alternative Names
HMGXB4; HMG box domain containing 4; HMG2L1; HMGBCG; THC211630; HMG domain-containing protein 4; HMG box-containing protein 4; high mobility group protein 2-like 1; high-mobility group protein 2-like 1;
High mobility group (HMG) proteins are nonhistone chromosomal proteins. See HMG2 (MIM 163906) for additional information on HMG proteins.[supplied by OMIM, Nov 2010]
Citations
Publication ()
Have you cited DPAB-DC095 in a publication? Let us know and earn a reward for your research.
My Review for Anti-HMGXB4 (aa 1-74) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
