Specifications
Immunogen
GTF2A1 (NP_056943, 1 a.a. ~ 63 a.a) partial recombinant protein with GST tag. The sequence is MANSANTNTVPKLYRSVIEDVINDVRDIFLDDGVDEQVLMELKTLWENKLMQSRAVDGFH SEE
Target
Alternative Names
GTF2A1; general transcription factor IIA, 1, 19/37kDa; TF2A1; TFIIA; TFIIAL; TFIIA-42; transcription initiation factor IIA subunit 1; TFIIA alpha, p55, isoform 1; general transcription factor IIA subunit 1; glucose regulated protein, 58kD pseudogene; tran
Product Background
Antigen Description
Accurate transcription initiation on TATA-containing class II genes involves the ordered assembly of RNA polymerase II (POLR2A; MIM 180660) and several general initiation factors (summarized by DeJong and Roeder, 1993 [PubMed 8224848]). One of these factors is TFIIA, which when purified from HeLa extracts consists of 35-, 19-, and 12-kD subunits.[supplied by OMIM, Jul 2010]
Pathway
Basal transcription factors; Disease; HIV Infection; HIV Transcription Initiation.
Citations
Publication ()
Have you cited DPAB-DC1498 in a publication?
Let us know and earn a reward for your research.
COA
Loading ......
