GSH2 (NP_573574, 1 a.a. ~ 70 a.a) partial recombinant protein with GST tag. The sequence is MSRSFYVDSLIIKDTSRPAPSLPEPHPGPDFFIPLGMPPPLVMSVSGPGCPSRKSGAFCV CPLCVTSHLH
Conjugate
Unconjugated
Target
Alternative Names
GSX2; GS homeobox 2; GSH2; homeobox protein GSH-2;
GSX2 (GS homeobox 2) is a protein-coding gene. Diseases associated with GSX2 include myeloid leukemia, and neuronitis. GO annotations related to this gene include sequence-specific DNA binding and sequence-specific DNA binding transcription factor activity. An important paralog of this gene is GSX1.
Citations
Publication ()
Have you cited DPAB-DC750 in a publication? Let us know and earn a reward for your research.
My Review for Anti-GSX2 (aa 1-70) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
