Synthetic peptide within Human CCDC75 aa 10-59 (N terminal). The exact sequence is proprietary.Sequence: DSFINVQEDIRPGLPMLRQIREARRKEEKQQEANLKNRQKSLKEEEQERR Database link: Q8N954
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
GPATCH11; G patch domain containing 11; CENPY; CCDC75; CENP-Y; G patch domain-containing protein 11; centromere protein Y; coiled-coil domain containing 75; g patch domain-containing protein 11; coiled-coil domain-containing protein 75;
GPATCH11 (G patch domain containing 11) is a protein-coding gene. Diseases associated with GPATCH11 include chronic lymphocytic leukemia , and leukemia. GO annotations related to this gene include nucleic acid binding.
Citations
Publication ()
Have you cited DPABH-12423 in a publication? Let us know and earn a reward for your research.
My Review for Anti-GPATCH11 (aa 10-59) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
