Synthetic peptide within Human Giantin aa 425-475. The exact sequence is proprietary.Sequence: DQLQQKSKEISQFLNRLPLQQHETASQTSFPDVYNEGTQAVTEENIASLQ K Database link: Q14789
Conjugate
Unconjugated
Target
Alternative Names
GOLGB1; golgin B1; GCP; GCP372; GOLIM1; Golgin subfamily B member 1; giantin; macrogolgin; golgi integral membrane protein 1; 372 kDa Golgi complex-associated protein; golgin B1, golgi integral membrane protein; golgi autoantigen, golgin subfamily b, macr
My Review for Rabbit anti-Human Giantin polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
