Recombinant fragment corresponding to Human GLTSCR1 aa 1278-1343.Sequence: ASSLDADEDGPMPSRNRPPIKTYEARSRIGLKLKIKQEAGLSKVVHNTAL DPVHQPPPPPATLKVA Database link: Q9NZM4
Conjugate
Unconjugated
Applications
Application Notes
IHC-P: 1/20 - 1/50;
Target
Alternative Names
GLTSCR1; glioma tumor suppressor candidate region gene 1; glioma tumor suppressor candidate region gene 1 protein;
This gene is a member of a phylogenetically conserved family of genes that share a common DNA-binding domain, the T-box. T-box genes encode transcription factors involved in the regulation of developmental processes. This gene is the human ortholog of mouse Tbx21/Tbet gene. Studies in mouse show that Tbx21 protein is a Th1 cell-specific transcription factor that controls the expression of the hallmark Th1 cytokine, interferon-gamma (IFNG). Expression of the human ortholog also correlates with IFNG expression in Th1 and natural killer cells, suggesting a role for this gene in initiating Th1 lineage development from naive Th precursor cells.
Citations
Publication ()
Have you cited DPABH-14965 in a publication? Let us know and earn a reward for your research.
My Review for Anti-GLTSCR1 (aa 1278-1343) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
