Synthetic peptide within Human GLIPR2 aa 78-127 (C terminal). The exact sequence is proprietary.Sequence: EVADRWYSEIKNYNFQQPGFTSGTGHFTAMVWKNTKKMGVGKASASDGSS Database link: Q9H4G4
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
GLIPR2; GLI pathogenesis-related 2; C9orf19, chromosome 9 open reading frame 19; Golgi-associated plant pathogenesis-related protein 1; GAPR 1; gliPR 2; 17kD fetal brain protein; golgi-associated PR-1 protein; glioma pathogenesis-related protein 2; GAPR-1
My Review for Anti-GLIPR2 (aa 78-127) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.