Anti-GATAD1 polyclonal antibody (DPAB-DC2614)

Mouse anti-Human GATAD1 (aa 82-190) polyclonal antibody for WB, ELISA

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
GATAD1 (NP_066990, 82 a.a. ~ 190 a.a) partial recombinant protein with GST tag. The sequence is KQSKQEIHRRSARLRNTKYKSAPAAEKKVSTKGKGRRHIFKLKNPIKAPESVSTIITAESIFYKGVYYQIGDVVSVIDEQDGKPYYAQIRGFIQDQYCEKSAALTWLIP
Conjugate
Unconjugated

Target


Alternative Names
GATAD1; GATA zinc finger domain containing 1; ODAG; CMD2B; RG083M05.2; GATA zinc finger domain-containing protein 1
Entrez Gene ID
UniProt ID

Product Background


Gene summary
GATAD1 (GATA Zinc Finger Domain Containing 1) is a Protein Coding gene. Diseases associated with GATAD1 include cardiomyopathy, dilated, 2b and gatad1-related dilated cardiomyopathy. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and sequence-specific DNA binding. The protein encoded by this gene contains a zinc finger at the N-terminus, and is thought to bind to a histone modification site that regulates gene expression. Mutations in this gene have been associated with autosomal recessive dilated cardiomyopathy. Alternatively spliced transcript variants have been found for this gene.
Antigen Description
The protein encoded by this gene contains a zinc finger at the N-terminus, and is thought to bind to a histone modification site that regulates gene expression. Mutations in this gene have been associated with autosomal recessive dilated cardiomyopathy. Alternatively spliced transcript variants have been found for this gene. Cardiomyopathy, dilated 2B (CMD2B) [MIM:614672]: A disorder characterized by ventricular dilation and impaired systolic function, resulting in congestive heart failure and arrhythmia. Patients are at risk of premature death. Note=The disease is caused by mutations affecting the gene represented in this entry. The function about GATAD1 antigen include sequence-specific DNA binding; sequence-specific DNA binding transcription factor activity; zinc ion binding.

Citations


Have you cited DPAB-DC2614 in a publication? Let us know and earn a reward for your research.

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket
Anti-Mouse IgG Fc polyclonal antibody [HRP] DPAB22321 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] DPAB22315 IF Rabbit PDF Inquiry
Anti-Mouse IgG2a polyclonal antibody [Biotin] DPAB22361 WB ELISA Rabbit PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [Biotin] DPAB22306 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [AP] DPAB22304 WB ELISA IHC Goat PDF Inquiry
Anti-Mouse IgG Fc polyclonal antibody [FITC] CPBT-68072GM IHC-Fr FC Goat PDF Inquiry
Anti-Mouse IgG monoclonal antibody, clone OX-20 [FITC] CABT-54559RM FC Rat PDF Inquiry
Product Name Cat. No. Applications Host Species Datasheet Price Add to Basket

References


Toh, Y; Kuninaka, S; et al. Molecular analysis of a candidate metastasis-associated gene, MTA1: Possible interaction with histone deacetylase 1. JOURNAL OF EXPERIMENTAL & CLINICAL CANCER RESEARCH 19:105-111(2000).

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket