Anti-GAS2L2 polyclonal antibody (DPAB-DC1159)

Mouse anti-Human GAS2L2 (aa 665-776) polyclonal antibody for ELISA Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
GAS2L2 (NP_644814, 665 a.a. ~ 776 a.a) partial recombinant protein with GST tag. The sequence is LLKVDLEAWKAAPTGSPKPAVTPGPGSLKGKLGARQSGPRTKASLSAKGTHMRKVPPQGGQDCSASTVSASPEAPTPSPLDPNSDKAKACLSKGRRTLRKPKRVPSIYKLKL
Conjugate
Unconjugated

Target


Alternative Names
GAS2L2; growth arrest-specific 2 like 2; GAR17; GAS2-like protein 2; GAS2-related protein on chromosome 17
Entrez Gene ID
UniProt ID

Citations


Have you cited DPAB-DC1159 in a publication? Let us know and earn a reward for your research.

References


Stroud, MJ; Nazgiewicz, A; et al. GAS2-like proteins mediate communication between microtubules and actin through interactions with end-binding proteins. JOURNAL OF CELL SCIENCE 127:2672-2682(2014).

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-GAS2L2 polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket