Synthetic peptide within Human GAMT aa 100-150 (internal sequence). The exact sequence is proprietary. (NP_000147.1).Sequence: RDWAPRQTHKVIPLKGLWEDVAPTLPDGHFDGILYDTYPLSEETWHTHQF N Database link: Q14353
GAMT (guanidinoacetate N-methyltransferase) is a protein-coding gene. Diseases associated with GAMT include guanidinoacetate methyltransferase deficiency, and creatine deficiency syndromes, and among its related super-pathways are Metabolic pathways and Urea cycle and metabolism of amino groups. GO annotations related to this gene include guanidinoacetate N-methyltransferase activity and methyltransferase activity.
Pathway
Arginine and proline metabolism; Creatine metabolism; Creatine pathway; Glycine, serine and threonine metabolism;
Citations
Publication ()
Have you cited DPABH-15058 in a publication? Let us know and earn a reward for your research.
My Review for Anti-GAMT (aa 100-150) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
