FUT5 (NP_002025, 95 a.a. ~ 164 a.a) partial recombinant protein with GST tag. The sequence is SEMVPGAADCNITADSSVYPQADAVIVHHWDIMYNPSANLPPPTRPQGQRWIWFSMESPS NCRHLEALDG
FUT5 (fucosyltransferase 5 (alpha (1,3) fucosyltransferase)) is a protein-coding gene. Diseases associated with FUT5 include cytomegalovirus infection, and herpes simplex, and among its related super-pathways are Metabolism. GO annotations related to this gene include 3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase activity and fucosyltransferase activity. An important paralog of this gene is FUT4.
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series.
Citations
Publication ()
Have you cited DPAB-DC1176 in a publication? Let us know and earn a reward for your research.
My Review for Anti-FUT5 (aa 95-164) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
