Synthetic peptide within Mouse FUCA2 aa 201-250 (internal sequence). The exact sequence is proprietary. NP_080075Sequence: SKTLPELYELVNRYQPEVLWSDGDGGAPDHYWNSTGFLAWLYNESPVRKT Database link: Q99KR8 Run BLAST with Run BLAST with
Alpha-L-fucosidase is responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins.
Pathway
Other glycan degradation;
Citations
Publication ()
Have you cited DPABH-27722 in a publication? Let us know and earn a reward for your research.
My Review for Anti-FUCA2 (aa 201-250) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
