Anti-FLNB polyclonal antibody (DPAB-DC1056)

Mouse Anti-Human FLNB (aa 2503-2602) polyclonal antibody for WB, ELISA Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
FLNB (NP_001448, 2503 a.a. ~ 2602 a.a) partial recombinant protein with GST tag. The sequence is SAIPKASSDASKVTSKGAGLSKAFVGQKSSFLVDCSKAGSNMLLIGVHGPTTPCEEVSMKHVGNQQYNVTYVVKERGDYVLAVKWGEEHIPGSPFHVTVP
Conjugate
Unconjugated

Target


Alternative Names
FLNB; filamin B, beta; AOI; FH1; SCT; TAP
Entrez Gene ID
UniProt ID

Product Background


Pathway
Antiviral mechanism by IFN-stimulated genes; Focal adhesion; Immune System; MAPK signaling pathway

Citations


Have you cited DPAB-DC1056 in a publication? Let us know and earn a reward for your research.

References


Bello, NF; Lamsoul, I; et al. The E3 ubiquitin ligase specificity subunit ASB2 beta is a novel regulator of muscle differentiation that targets filamin B to proteasomal degradation. CELL DEATH AND DIFFERENTIATION 16:921-932(2009).
Jugessur, A; Shi, M; et al. Maternal Genes and Facial Clefts in Offspring: A Comprehensive Search for Genetic Associations in Two Population-Based Cleft Studies from Scandinavia. PLOS ONE 5:-(2010).

Related Products


Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-FLNB polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket