Synthetic peptide within Human Kindlin 2 aa 402-451 (C terminal). The exact sequence is proprietary.Sequence: TSISCYKSKEESSGTPAHQMNLRGCEVTPDVNISGQKFNIKLLIPVAEGM Database link: NP_006823
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
FERMT2; fermitin family member 2; MIG2; KIND2; mig-2; UNC112; PLEKHC1; UNC112B; fermitin family homolog 2; kindlin 2; kindlin-2; mitogen inducible gene 2 protein; mitogen-inducible gene 2 protein; PH domain-containing family C member 1; pleckstrin homolog
Participates in the connection between ECM adhesion sites and the actin cytoskeleton and also in the orchestration of actin assembly and cell shape modulation. Recruits migfilin (FBLP1) protein to cell-ECM focal adhesion sites.
My Review for Anti-FERMT2 (aa 402-451) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
