Synthetic peptide corresponding to a region from internal sequence amino acids 432-481 (IDTSGFPDLSDNRNEDPLVLLAWRCTKLSLLAIHGYTVWAHNLIAIARL R) of Human FBXO33 (NP_976046).
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
FBXO33; F-box protein 33; F box only protein 33; F-box only protein 33; Fbx33; BMND12; c14_5247;
Substrate recognition component of a (SKP1-CUL1-F-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins. Probably recognizes and binds to phosphorylated target proteins. Recognizes YBX1.
Citations
Publication ()
Have you cited DPABH-19006 in a publication? Let us know and earn a reward for your research.
My Review for Anti-FBXO33 (aa 432-481) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
