Synthetic peptide within Human FAM65A aa 284-333 (N terminal). The exact sequence is proprietary. (NP_078795).Sequence: SCETKDLFAALPQVVAVDINDLGTIKLSLEVTWSPFDKDDQPSAASSVNK Database link: Q6ZS17-2
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
FAM65A; family with sequence similarity 65, member A; protein FAM65A;
This gene encodes a tumor suppressor that is involved in transcriptional and post-transcriptional control pathways. The protein is a component of the the PAF protein complex, which associates with the RNA polymerase II subunit POLR2A and with a histone methyltransferase complex. This protein appears to facilitate the association of 3 mRNA processing factors with actively-transcribed chromatin. Mutations in this gene have been linked to hyperparathyroidism-jaw tumor syndrome, familial isolated hyperparathyroidism, and parathyroid carcinoma.
Citations
Publication ()
Have you cited DPABH-12639 in a publication? Let us know and earn a reward for your research.
My Review for Anti-FAM65A (aa 284-333) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
