Recombinant protein corresponding to amino acids of human FAM219A. The sequence is MEEIDRFQVPTAHSEMQPLDPAAASISDGDCDAREGESVAMNYKPSPLQVKLEKQRELAR KGSLKNGSM
Conjugate
Unconjugated
Applications
Application Notes
IHC: 1:200-1:500. & The optimal working dilution should be determined by the end user.
Target
Alternative Names
FAM219A; family with sequence similarity 219, member A; C9orf25; bA573M23.5; protein FAM219A; uncharacterized protein C9orf25;
The protein encoded by this gene has homologs that have been identified in mouse, macaque, etc organisms. Multiple alternatively spliced transcript variants that encode different protein isoforms have been described for this gene.
Citations
Publication ()
Have you cited DPAB-DC860 in a publication? Let us know and earn a reward for your research.
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
