Synthetic peptide corresponding to a region within N terminal amino acids 42-91 (VIKQGTCEVVAVHRCCNKNRIEERSQTVKCSCFPGQVAGTTRAQPSCVE A) of rat FAM19A4 (NP_001128172).
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
FAM19A4; family with sequence similarity 19 (chemokine (C-C motif)-like), member A4; protein FAM19A4; family with sequence similarity 19, member A4;
FAM19A4 is a member of the TAFA family which is composed of five highly homologous genes that encode small secreted proteins. These proteins contain conserved cysteine residues at fixed positions, and are distantly related to MIP-1alpha, a member of the CC-chemokine family. The TAFA proteins are predominantly expressed in specific regions of the brain, and are postulated to function as brain-specific chemokines or neurokines, that act as regulators of immune and nervous cells. Transcript variants with different 5 UTRs, but encoding the same protein, have been found for this gene.
Citations
Publication ()
Have you cited DPABH-29231 in a publication? Let us know and earn a reward for your research.
My Review for Anti-FAM19A4 (aa 42-91) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
