Synthetic peptide corresponding to a region within C terminal amino acids 155-204 (QFLRHYLENYPIAPGRIQELEERRRRFVEACRAREAAFDIEYLRNPQRV D) of Mouse EID2 (NM_198425).
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
EID2; EP300 interacting inhibitor of differentiation 2; Cri2; EID-2; EP300-interacting inhibitor of differentiation 2; CREBBP/EP300 inhibitor 2; CREBBP/EP300 inhibitory protein 2; E1A like inhibitor of differentiation 2; EID-1-like inhibitor of differenti
Interacts with EP300 and acts as a repressor of MYOD-dependent transcription and muscle differentiation. Inhibits EP300 histone acetyltransferase activity. Acts as a repressor of TGFB/SMAD transcriptional responses. May act as a repressor of the TGFB/SMAD3-dependent signaling by selectively blocking formation of TGFB-induced SMAD3-SMAD4 complex.
Pathway
TGF-beta Receptor Signaling Pathway.
Citations
Publication ()
Have you cited DPABH-28349 in a publication? Let us know and earn a reward for your research.
My Review for Anti-EID2 (aa 155-204) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
