Synthetic peptide corresponding to a region within C terminal amino acids 359-408 (KTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALM H) of Human DNAJC7 (NP_003306).
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
DNAJC7; DnaJ (Hsp40) homolog, subfamily C, member 7; TTC2; dnaJ homolog subfamily C member 7; TPR2; TPR repeat protein 2; tetratricopeptide repeat domain 2; tetratricopeptide repeat protein 2; DJ11; DJC7;
The DNAJC7 gene encodes a member of the DNAJ heat shock protein 40 family of proteins that is characterized by a C-terminal DNAJ domain and two N-terminal tetratricopeptide repeat domains. This protein binds the chaperone proteins heat shock proteins 70 and 90 in an ATP-dependent manner and may function as a co-chaperone. Pseudogenes of this gene are found on chromosomes 1 and 6. Alternate splicing results in multiple transcript variants.
Custom Antibody Labeling
We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More
Citations
Have you cited DPABH-25484 in a publication? Let us know and earn a reward for your research.
Durrenberger, PF; Filiou, MD; et al. DnaJB6 Is Present in the Core of Lewy Bodies and Is Highly Up-Regulated in Parkinsonian Astrocytes. JOURNAL OF NEUROSCIENCE RESEARCH 87:238-245(2009).
Payment methods we support:
Invoice / Purchase Order
Credit card
My Review for Anti-DNAJC7 polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Certificate of Analysis
