Synthetic peptide within Human FAM116B aa 120-169 (N terminal). The exact sequence is proprietary. Genbank: NP_001001794Sequence: PVALQREPAHYFGYVYFRQVKDSSVKRGYFQKSLVLVSRLPFVRLFQALL Database link: Q8NEG7
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
DENND6B; DENN/MADD domain containing 6B; AFI1B; FAM116B; protein DENND6B; protein FAM116B; DENN domain-containing protein 6B; family with sequence similarity 116, member B;
DENND6B (DENN/MADD domain containing 6B) is a protein-coding gene. GO annotations related to this gene include Rab guanyl-nucleotide exchange factor activity. An important paralog of this gene is DENND6A.
Custom Antibody Labeling
We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More
Citations
Have you cited DPABH-14116 in a publication? Let us know and earn a reward for your research.
Payment methods we support:
Invoice / Purchase Order
Credit card
My Review for Anti-DENND6B polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Certificate of Analysis