Anti-DCST1 polyclonal antibody (DPAB-DC655)

Mouse anti-Human DCST1 (aa 532-630) polyclonal antibody for WB, ELISA Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
DCST1 (NP_689707, 532 a.a. ~ 630 a.a) partial recombinant protein with GST tag. The sequence is MESNNMPCLPQPVGLDARAYWRAAVPIGLLVCLCLLQAFGYRLRRVIAAFYFPKREKKRILFLYNDLLKKRAAFTKLRRAAILRRERQQKAPRHPLADI
Conjugate
Unconjugated

Target


Alternative Names
DCST1; DC-STAMP domain containing 1; DC-STAMP domain-containing protein 1
Entrez Gene ID
UniProt ID

Citations


Have you cited DPAB-DC655 in a publication? Let us know and earn a reward for your research.

References


Chiu, YH; Mensah, KA; et al. Regulation of human osteoclast development by dendritic cell-specific transmembrane protein (DC-STAMP). JOURNAL OF BONE AND MINERAL RESEARCH 27:79-92(2012).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-DCST1 polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket