Anti-COL24A1 polyclonal antibody (DPAB-DC1216)

Mouse anti-Human COL24A1 (aa 1626-1714) polyclonal antibody for WB, ELISA Datasheet

Online Inquiry Add to basket

Specifications


Host Species
Mouse
Species Reactivity
Human
Immunogen
COL24A1 (NP_690850, 1626 a.a. ~ 1714 a.a) partial recombinant protein with GST tag. The sequence is PRWTSTQTSGPGLPIGFKGWNGQIFKVNTLLEPKVLSDDCKIQDGSWHKATFLFHTQEPNQLPVIEVQKLPHLKTERKYYIDSSSVCFL
Conjugate
Unconjugated

Target


Alternative Names
COL24A1; collagen, type XXIV, alpha 1; collagen alpha-1(XXIV) chain
Entrez Gene ID
UniProt ID

Product Background


Antigen Description
COL24A1 (collagen, type XXIV, alpha 1) is a protein-coding gene. Among its related super-pathways are Collagen biosynthesis and modifying enzymes and FAK1 Signaling. GO annotations related to this gene include extracellular matrix structural constituent. An important paralog of this gene is COL4A6. The function about COL24A1 antigen include extracellular matrix structural constituent.
Pathway
ATF-2 transcription factor network; Amoebiasis; Collagen biosynthesis and modifying enzymes; ECM-receptor interaction.

Citations


Have you cited DPAB-DC1216 in a publication? Let us know and earn a reward for your research.

References


Lampe, V; Dierks, C; et al. Refinement of a quantitative trait locus on equine chromosome 5 responsible for fetlock osteochondrosis in Hanoverian warmblood horses. ANIMAL GENETICS 40:553-555(2009).
Koch, M; Laub, F; et al. Collagen XXIV, a vertebrate fibrillar collagen with structural features of invertebrate collagens - Selective expression in developing cornea and bone. JOURNAL OF BIOLOGICAL CHEMISTRY 278:43236-43244(2003).

Custom Antibody Labeling


We offer labeled antibodies using our catalogue antibody products and a broad range of intensely fluorescent dyes and labels including HRP, biotin, ALP, Alexa Fluor® dyes, DyLight® Fluor dyes, R-phycoerythrin (R-PE), at scales from less than 100 μg up to 1 g of IgG antibody. Learn More

Customer Reviews


Write a review, share your experiences with others and get rewarded !

Online Inquiry

Name:
Phone: *
E-mail Address: *
Service & Products Interested: *
Project Description:
Verification Code: * Please input "diagnostics" as verification code.

Online Inquiry

Order Info: Anti-COL24A1 polyclonal antibody

Online Inquiry
  Interested in larger quantities ? request a quote!
  Protocol may be improved. Please feel free to contact us to obtain the latest version.!
  15% off your first purchase

Ordering Information

Payment methods we support:
Invoice / Purchase Order
Credit card

OUR PROMISE TO YOU Guaranteed product quality expert customer support

Inquiry Basket