CKLFSF4 (NP_848933, 173 a.a. ~ 234 a.a) partial recombinant protein with GST tag. The sequence is QKWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFSYSTNVTVRKKSPTNLLSLNHWQ LA
Conjugate
Unconjugated
Target
Alternative Names
CMTM4; CKLF-like MARVEL transmembrane domain containing 4; CKLFSF4; CKLF-like MARVEL transmembrane domain-containing protein 4; chemokine-like factor super family 4; chemokine-like factor superfamily member 4;
This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. Alternatively spliced transcript variants encoding different isoforms have been identified.
Citations
Publication ()
Have you cited DPAB-DC633 in a publication? Let us know and earn a reward for your research.
My Review for Anti-CMTM4 (aa 173-234) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
