Recombinant fragment corresponding to Human CLEC3A aa 94-156.Sequence: DCISKGGILVIPRNSDEINALQDYGKRSLPGVNDFWLGINDMVTEGKFVD VNGIAISFLNWDR Database link: O75596
Conjugate
Unconjugated
Applications
Application Notes
IHC-P: 1/5000 - 1/10000;
Target
Alternative Names
CLEC3A; C-type lectin domain family 3, member A; CLECSF1; C-type lectin domain family 3 member A; C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 1 (cartilage-derived);
My Review for Anti-CLEC3A (aa 94-156) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
