CLDN5 (NP_003268, 29 a.a. ~ 81 a.a) partial recombinant protein with GST tag. The sequence is MWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAAR
Conjugate
Unconjugated
Target
Alternative Names
CLDN5; claudin 5; AWAL; BEC1; TMVCF; CPETRL1; claudin-5; TMDVCF; transmembrane protein deleted in VCFS; transmembrane protein deleted in velocardiofacial syndrome;
This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets. Mutations in this gene have been found in patients with velocardiofacial syndrome. Alternatively spliced transcript variants encoding the same protein have been found for this gene.
My Review for Anti-CLDN5 (aa 29-81) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.