Synthetic peptide within Rat CIB1 aa 2-51 (N terminal). The exact sequence is proprietary.Sequence: GGSGSRLSKELLAEYQDLTFLTKQEILLAHRRFCELLPPEHRTVEESLHT Database link: NP_112407
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
CIB1; calcium and integrin binding 1 (calmyrin); calcium and integrin-binding protein 1; KIP; calmyrin; kinase-interacting protein; DNA-PKcs-interacting protein; calcium- and integrin-binding protein; Cib; Sip2-28;
May convert the inactive conformation of integrin alpha-IIb/beta3 to an active form through binding to the integrin cytoplasmic domain. Induces cell migration and spreading mediated through integrin (possibly via focal adhesion complexes). Functions as a negative regulator of stress activated MAP kinase (MAPK) signaling pathways. May play a role in regulation of apoptosis. Interacts with and up-regulates PTK2 activity. Down regulates inositol 1,4,5-trisphosphate receptor-dependent calcium signaling.
Citations
Publication ()
Have you cited DPABH-28902 in a publication? Let us know and earn a reward for your research.
My Review for Anti-CIB1 (aa 2-51) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
