Synthetic peptide within Rat CCDC85A aa 401-450 (internal sequence). The exact sequence is proprietary.Sequence: YSGMNESTLSYVRQLEARVRQLEEENRMLPQATQNRSQPPTRNSSNMEKG Database link: NP_001178482
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml;
Target
Alternative Names
CCDC85A; coiled-coil domain containing 85A; RGD1311700; coiled-coil domain-containing protein 85A;
CCDC85A (coiled-coil domain containing 85A) is a protein-coding gene. Diseases associated with CCDC85A include neurofibromatosis. An important paralog of this gene is CCDC85B.
Citations
Publication ()
Have you cited DPABH-28948 in a publication? Let us know and earn a reward for your research.
My Review for Anti-CCDC85A (aa 401-450) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
