Anti-CCDC79 (aa 441-490) polyclonal antibody

Antibody Isotype

IgG

Species Reactivity

Human

Immunogen

Synthetic peptide within Human CCDC79 aa 441-490 (C terminal). The exact sequence is proprietary. (NP_001129977).Sequence: ISIQNTWKHLHADRIGRGSKAEDEDKSHSRQLQSYKSHGVMSKACTNDDQ Database link: Q8NA31

Conjugate

Application Notes

WB: 1 μg/ml;

Alternative Names

CCDC79; coiled-coil domain containing 79; telomere repeats-binding bouquet formation protein 1; coiled-coil domain-containing protein 79;

Entrez Gene ID

UniProt ID

Antigen Description

This gene encodes a member of the carboxylesterase large family. The family members are responsible for the hydrolysis or transesterification of various xenobiotics, such as cocaine and heroin, and endogenous substrates with ester, thioester, or amide bonds. They also participate in fatty acyl and cholesterol ester metabolism, and may play a role in the blood-brain barrier system. This gene, also called CES6, encodes a secreted enzyme, and may play a role in the detoxification of drugs and xenobiotics in neural and other tissues of the body and in the cerebrospinal fluid. Multiple transcript variants encoding different isoforms have been reported, but the full-length nature and/or biological validity of some variants have not been determined.