Full length native protein (purified) corresponding to Cow Carbonic Anhydrase I aa 2-261. Carbonic anhydrase from Bovine erythrocytes.Sequence: ASPDWGYDGENGPEHWGKLYPIANGNNQSPIDIKTSETKRDPSLKPLSVS YNPATAKEIVNVGHSFHVNFEDSDNRSVLKGGPLSESYRLRQFHFHWGIT DDCGSEHLV
My Review for Anti-CA1 (native protein) polyclonal antibody [Biotin]
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
