Synthetic peptide within Human C9orf41 aa 142-191 (internal sequence). The exact sequence is proprietary. (NP_689633).Sequence: DGNGKIMPASTFDMDKLKSTLKQFVRDWSETGKAERDACYQPIIKEILKN Database link: Q8N4J0
Conjugate
Unconjugated
Applications
Application Notes
WB: 1 μg/ml.
Target
Alternative Names
C9ORF41; chromosome 9 open reading frame 41; UPF0586 protein C9orf41; FLJ25795;
My Review for Anti-C9ORF41 (aa 142-191) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
