Recombinant protein corresponding to amino acids of recombinant C6orf47. The sequence is EPSKEEPQVEQLGSKRMDSLKWDQPISSTQESGRLEAGGASPKLRWDHVDSGGTRRPGVS PEGGLSVPGPGAPLEK
Conjugate
Unconjugated
Applications
Application Notes
IHC: 1:1000-1:2500; WB: 1:100-1:250; IF: 1-4 μg/mL. & The optimal working dilution should be determined by the end user.
Target
Alternative Names
C6ORF47; chromosome 6 open reading frame 47; G4; NG34; D6S53E; uncharacterized protein C6orf47; protein G4;
C6orf47 (chromosome 6 open reading frame 47) is a protein-coding gene. Diseases associated with C6orf47 include human t-cell leukemia virus type 1, and gastroenteritis.
Citations
Publication ()
Have you cited DPAB-DC2616 in a publication? Let us know and earn a reward for your research.
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
