C21orf33 (NP_004640, 188 a.a. ~ 268 a.a) partial recombinant protein with GST tag. The sequence is RGVEVTVGHEQEEGGKWPYAGTAEAIKALGAKHCVKEVVEAHVDQKNKVVTTPAFMCETA LHYIHDGIGAMVRKVLELTGK
Conjugate
Unconjugated
Target
Alternative Names
C21ORF33; chromosome 21 open reading frame 33; ES1; HES1; KNPH; KNPI; GT335; ES1 protein homolog, mitochondrial; Keio novel protein I; human HES1 protein, homolog to E.coli and zebrafish ES1 protein;
This gene encodes a potential mitochondrial protein that is a member of the DJ-1/PfpI gene family. This protein is overexpressed in fetal Down syndrome brain. Alternate splicing results in multiple transcript variants.
Pathway
Gastric cancer network 1;
Citations
Publication ()
Have you cited DPAB-DC3369 in a publication? Let us know and earn a reward for your research.
My Review for Anti-C21ORF33 (aa 188-268) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
