Recombinant protein corresponding to amino acids of human C19orf12. The sequence is GAWMTSGQFKPVPQILMELPPAEQQRLFNEAAAIIRHLEWTDAVQLTALVMGSEALQQQL LAMLVNYVTKELRAEIQ
Conjugate
Unconjugated
Applications
Application Notes
IHC: 1:50-1:200. & The optimal working dilution should be determined by the end user.
Target
Alternative Names
C19ORF12; chromosome 19 open reading frame 12; NBIA3; NBIA4; SPG43; protein C19orf12; spastic paraplegia 43 (autosomal recessive); neurodegeneration with brain iron accumulation 3;
This gene encodes a small transmembrane protein. Mutations in this gene are a cause of neurodegeneration with brain iron accumulation-4 (NBIA4), but the specific function of the encoded protein is unknown. Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.
Citations
Publication ()
Have you cited DPAB-DC3433 in a publication? Let us know and earn a reward for your research.
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
