BICD1 (NP_001705, 1 a.a. ~ 70 a.a) partial recombinant protein with GST tag. The sequence is MAAEEVLQTVDHYKTEIERLTKELTETTHEKIQAAEYGLVVLEEKLTLKQQYDELEAEYD SLKQELEQLK
Conjugate
Unconjugated
Target
Alternative Names
BICD1; bicaudal D homolog 1 (Drosophila); BICD; protein bicaudal D homolog 1; bic-D 1; cytoskeleton-like bicaudal D protein homolog 1;
This gene is one of two human homologs of Drosophila bicaudal-D. It has been implicated in COPI-independent membrane transport from the Golgi apparatus to the endoplasmic reticulum. Two alternative splice variants have been described. Other alternative splice variants that encode different protein isoforms have been described but their full-length nature has not been determined.
Citations
Publication ()
Have you cited DPAB-DC2796 in a publication? Let us know and earn a reward for your research.
My Review for Anti-BICD1 (aa 1-70) polyclonal antibody
Creative Diagnostics products are for RESEARCH USE ONLY, please make sure your review is research based.
Required fields are marked with *
Terms and conditions:
We will select high-quality review customers and offer a $30 coupon for your next purchase.
All product reviews must be submitted in the English language.
Creative Diagnostics will not share any personal information of applicants, and all information will be treated with strict confidentiality and will not be sold or disclosed to a third party.
COA
Publication 
Loading ......
